PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00649.1.g00170.1.am.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 272aa    MW: 30658.8 Da    PI: 10.0868
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00649.1.g00170.1.am.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.91.5e-151454748
                                    HHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                 Myb_DNA-binding  7 eEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                    +Ede++++ v++lG++ W+tIa+ ++ gR +kqc++rw+++l
  Zpz_sc00649.1.g00170.1.am.mkhc 14 QEDEIIIQMVNKLGPKKWSTIAQALP-GRIGKQCRERWHNHL 54
                                    6*************************.*************97 PP

2Myb_DNA-binding30.86.8e-106091134
                                    TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTT CS
                 Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkg 34
                                    + +WT+eE+ +l++a++ +G++ W+  ++ ++ g
  Zpz_sc00649.1.g00170.1.am.mkhc 60 KEAWTQEEEIRLIHAHQTYGNK-WAELSKFLP-G 91
                                    579*******************.*******99.3 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.089158IPR017930Myb domain
SMARTSM007177.4E-91356IPR001005SANT/Myb domain
CDDcd001672.75E-121454No hitNo description
SuperFamilySSF466891.15E-211491IPR009057Homeodomain-like
PfamPF139211.2E-151471No hitNo description
Gene3DG3DSA:1.10.10.602.2E-231461IPR009057Homeodomain-like
SMARTSM007173.4E-759128IPR001005SANT/Myb domain
PROSITE profilePS512948.12859105IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-1362104IPR009057Homeodomain-like
CDDcd001672.11E-56291No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MFHVGCSFII SYFQEDEIII QMVNKLGPKK WSTIAQALPG RIGKQCRERW HNHLNPGINK  60
EAWTQEEEIR LIHAHQTYGN KWAELSKFLP GSGISLGRRQ VGPRAQPRLR ATRLEQQLLQ  120
QYEYMNIMAD TPSVKRGLES PSAWKSPLFT AFQGAYFMSP AARAFDALGL VKQINDQRAD  180
ALEEAHEVLA SGSTKNRHSK GKWDKENTKS SLWNNGLIIS KLSSEVMAEA RVLDFNDCST  240
PARKKDDRNV DSKLGGSASS PVASSYIRMN VR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-2914911087MYB PROTO-ONCOGENE PROTEIN
1mse_C1e-2914911087C-Myb DNA-Binding Domain
1msf_C1e-2914911087C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0171288e-59BT017128.1 Zea mays clone EL01N0365C01.c mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960645.12e-63PREDICTED: myb-related protein 3R-1
RefseqXP_004960646.12e-63PREDICTED: myb-related protein 3R-1
RefseqXP_004960647.12e-63PREDICTED: myb-related protein 3R-1
TrEMBLA0A0A9D3C24e-74A0A0A9D3C2_ARUDO; Uncharacterized protein
STRINGSi021218m1e-63(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.12e-41myb domain protein 3r-4